Recombinant Rat Podocalyxin (Podxl), partial

In Stock
Code CSB-YP893876RA
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Podxl; Pclp1; Podocalyxin; Podocalyxin-like protein 1; PC; PCLP-1
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
25-386aa
Target Protein Sequence
QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Gene References into Functions
  1. podocalyxin has a role in defining the structure of the podocyte basal surface PMID: 15226400
  2. Podocalyxin might be associated with the malignant progression of astrocytic tumors, and be a useful prognostic marker for astrocytic tumors. PMID: 18639524
  3. Report ubiquitous yet distinct expression of podocalyxin on vascular surfaces in normal and tumor tissues in the rat. PMID: 19142011
Subcellular Location
Apical cell membrane. Cell projection, microvillus. Membrane raft. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Membrane; Single-pass type I membrane protein.
Protein Families
Podocalyxin family
Tissue Specificity
Glomerular epithelium cell (podocyte) (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*